PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0401s0007.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 214aa    MW: 24151.8 Da    PI: 8.7092
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0401s0007.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1023.4e-32133191159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+++r ++d+ vv++tYeg H h+
  Kalax.0401s0007.1.p 133 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQIQRVSKDEGVVITTYEGFHSHP 191
                          59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.7E-33118192IPR003657WRKY domain
SuperFamilySSF1182907.06E-29125192IPR003657WRKY domain
PROSITE profilePS5081129.539128193IPR003657WRKY domain
SMARTSM007741.7E-37133192IPR003657WRKY domain
PfamPF031063.1E-26134191IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MFMAFDQISN SASSRHVSLA SIIPVSASES QLFKSHMATS SMLAPGLMEM QQQQQQQERG  60
VKRSSLDESS NNNCENNNES GCIDAQSCDS VVGMKQQISN AAAATSDQGV EKEEKRKKKH  120
RYAFQTRSHV DILDDGYRWR KYGQKAVKNN KFPRSYYRCT HQGCNVKKQI QRVSKDEGVV  180
ITTYEGFHSH PTIQNSSDNF EHILTQMNIY NNN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-28123190774Probable WRKY transcription factor 4
2lex_A3e-28123190774Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010249071.13e-60PREDICTED: probable WRKY transcription factor 75
TrEMBLK3ZJV48e-59K3ZJV4_SETIT; Uncharacterized protein
STRINGSi026859m2e-58(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.17e-53WRKY DNA-binding protein 75